PDB entry 1bxn

View 1bxn on RCSB PDB site
Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
Class: lyase
Keywords: lyase (carbon-carbon), lyase
Deposited on 1998-10-06, released 1999-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribulose bisphosphate carboxylase large chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN
    Domains in SCOPe 2.07: d1bxna1, d1bxna2
  • Chain 'C':
    Compound: protein (ribulose bisphosphate carboxylase large chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN
    Domains in SCOPe 2.07: d1bxnc1, d1bxnc2
  • Chain 'E':
    Compound: protein (ribulose bisphosphate carboxylase large chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN
    Domains in SCOPe 2.07: d1bxne1, d1bxne2
  • Chain 'G':
    Compound: protein (ribulose bisphosphate carboxylase large chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN
    Domains in SCOPe 2.07: d1bxng1, d1bxng2
  • Chain 'I':
    Compound: protein (ribulose bisphosphate carboxylase small chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN (0-End)
    Domains in SCOPe 2.07: d1bxni_
  • Chain 'J':
    Compound: protein (ribulose bisphosphate carboxylase small chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN (0-End)
    Domains in SCOPe 2.07: d1bxnj_
  • Chain 'K':
    Compound: protein (ribulose bisphosphate carboxylase small chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN (0-End)
    Domains in SCOPe 2.07: d1bxnk_
  • Chain 'L':
    Compound: protein (ribulose bisphosphate carboxylase small chain)
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXN (0-End)
    Domains in SCOPe 2.07: d1bxnl_
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bxnA (A:)
    mnapesvqakprkrydagvmkykmgywdgdyvpkdtdllalfritpqdgvdpveaaaava
    gesstatwtvvwtdrltacdmyrakayrvdpvpnnpeqffcyvaydlslfeegsianlta
    siignvfsfkpikaarledmrfpvayvktfagpstgiivererldkfgrpllgattkpkl
    glsgrnygrvvyeglkggldfmkddeninsqpfmhwrdrflfvmdavnkasaatgevkgs
    ylnvtagtmeemyrraefakslgsviimvdlivgwtciqsmsnwcrqndmilhlhraghg
    tytrqknhgvsfrviakwlrlagvdhmhtgtavgklegdpltvqgyynvcrdaytqtdlt
    rglffdqdwaslrkvmpvasggihagqmhqlihlfgddvvlqfgggtighpqgiqagata
    nrvaleamvlarnegrdilnegpeilrdaarwcgplraaldtwgdisfnytptdtsdfap
    tasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnA (A:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bxnC (C:)
    mnapesvqakprkrydagvmkykmgywdgdyvpkdtdllalfritpqdgvdpveaaaava
    gesstatwtvvwtdrltacdmyrakayrvdpvpnnpeqffcyvaydlslfeegsianlta
    siignvfsfkpikaarledmrfpvayvktfagpstgiivererldkfgrpllgattkpkl
    glsgrnygrvvyeglkggldfmkddeninsqpfmhwrdrflfvmdavnkasaatgevkgs
    ylnvtagtmeemyrraefakslgsviimvdlivgwtciqsmsnwcrqndmilhlhraghg
    tytrqknhgvsfrviakwlrlagvdhmhtgtavgklegdpltvqgyynvcrdaytqtdlt
    rglffdqdwaslrkvmpvasggihagqmhqlihlfgddvvlqfgggtighpqgiqagata
    nrvaleamvlarnegrdilnegpeilrdaarwcgplraaldtwgdisfnytptdtsdfap
    tasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnC (C:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bxnE (E:)
    mnapesvqakprkrydagvmkykmgywdgdyvpkdtdllalfritpqdgvdpveaaaava
    gesstatwtvvwtdrltacdmyrakayrvdpvpnnpeqffcyvaydlslfeegsianlta
    siignvfsfkpikaarledmrfpvayvktfagpstgiivererldkfgrpllgattkpkl
    glsgrnygrvvyeglkggldfmkddeninsqpfmhwrdrflfvmdavnkasaatgevkgs
    ylnvtagtmeemyrraefakslgsviimvdlivgwtciqsmsnwcrqndmilhlhraghg
    tytrqknhgvsfrviakwlrlagvdhmhtgtavgklegdpltvqgyynvcrdaytqtdlt
    rglffdqdwaslrkvmpvasggihagqmhqlihlfgddvvlqfgggtighpqgiqagata
    nrvaleamvlarnegrdilnegpeilrdaarwcgplraaldtwgdisfnytptdtsdfap
    tasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnE (E:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bxnG (G:)
    mnapesvqakprkrydagvmkykmgywdgdyvpkdtdllalfritpqdgvdpveaaaava
    gesstatwtvvwtdrltacdmyrakayrvdpvpnnpeqffcyvaydlslfeegsianlta
    siignvfsfkpikaarledmrfpvayvktfagpstgiivererldkfgrpllgattkpkl
    glsgrnygrvvyeglkggldfmkddeninsqpfmhwrdrflfvmdavnkasaatgevkgs
    ylnvtagtmeemyrraefakslgsviimvdlivgwtciqsmsnwcrqndmilhlhraghg
    tytrqknhgvsfrviakwlrlagvdhmhtgtavgklegdpltvqgyynvcrdaytqtdlt
    rglffdqdwaslrkvmpvasggihagqmhqlihlfgddvvlqfgggtighpqgiqagata
    nrvaleamvlarnegrdilnegpeilrdaarwcgplraaldtwgdisfnytptdtsdfap
    tasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnG (G:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1bxnI (I:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesyavqagpegsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnI (I:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1bxnJ (J:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesyavqagpegsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnJ (J:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1bxnK (K:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesyavqagpegsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnK (K:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1bxnL (L:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesyavqagpegsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxnL (L:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya