PDB entry 1bxg

View 1bxg on RCSB PDB site
Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate
Deposited on 1998-10-02, released 1999-05-18
The last revision prior to the SCOP 1.61 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxgA (A:)
    sidsalnwdgemtvtrfdsktgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxgB (B:)
    sidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrare