PDB entry 1bx9

View 1bx9 on RCSB PDB site
Description: glutathione s-transferase in complex with herbicide
Deposited on 1998-10-14, released 1998-10-21
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bx9A (A:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq