PDB entry 1bww

View 1bww on RCSB PDB site
Description: bence-jones immunoglobulin rei variable portion, t39k mutant
Deposited on 1998-09-29, released 1998-10-07
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1824
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bwwa_
  • Chain 'B':
    Domains in SCOP 1.65: d1bwwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwA (A:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwB (B:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit