PDB entry 1bww

View 1bww on RCSB PDB site
Description: bence-jones immunoglobulin rei variable portion, t39k mutant
Class: immune system
Keywords: reiv, stabilized immunoglobulin fragment, bence-jones protein, immune system
Deposited on 1998-09-29, released 1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ig kappa chain v-I region rei)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01607 (2-108)
    • conflict (0-1)
    • engineered (40)
  Domains in SCOPe 2.08: d1bwwa_
• Chain 'B':
  Compound: protein (ig kappa chain v-I region rei)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01607 (2-108)
    • conflict (0-1)
    • engineered (40)
  Domains in SCOPe 2.08: d1bwwb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwwA (A:)
  tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
  psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwwB (B:)
  tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
  psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit