PDB entry 1bwv

View 1bwv on RCSB PDB site
Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
Class: lyase
Keywords: carbon dioxide fixation, complex (rubisco-reaction intermediate), high specificity factor, lyase
Deposited on 1998-09-29, released 1999-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98949
      • modified residue (209)
    Domains in SCOPe 2.07: d1bwva1, d1bwva2
  • Chain 'C':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98949
      • modified residue (209)
    Domains in SCOPe 2.07: d1bwvc1, d1bwvc2
  • Chain 'E':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98949
      • modified residue (209)
    Domains in SCOPe 2.07: d1bwve1, d1bwve2
  • Chain 'G':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98949
      • modified residue (209)
    Domains in SCOPe 2.07: d1bwvg1, d1bwvg2
  • Chain 'S':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98950 (0-137)
      • conflict (0)
    Domains in SCOPe 2.07: d1bwvs_
  • Chain 'U':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98950 (0-137)
      • conflict (0)
    Domains in SCOPe 2.07: d1bwvu_
  • Chain 'W':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98950 (0-137)
      • conflict (0)
    Domains in SCOPe 2.07: d1bwvw_
  • Chain 'Y':
    Compound: protein (ribulose bisphosphate carboxylase)
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O98950 (0-137)
      • conflict (0)
    Domains in SCOPe 2.07: d1bwvy_
  • Heterogens: MG, CAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bwvA (A:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwvA (A:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bwvC (C:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwvC (C:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bwvE (E:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwvE (E:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bwvG (G:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwvG (G:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvS (S:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvU (U:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvW (W:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvY (Y:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery