PDB entry 1bwm

View 1bwm on RCSB PDB site
Description: a single-chain t cell receptor
Deposited on 1998-09-23, released 1999-07-22
The last revision prior to the SCOP 1.57 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwmA (A:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgsdykddddk
    rsggggsggggsggsgaqqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgks
    palliaislvsnkkedgrftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfga
    gtrlavspy