PDB entry 1bwb

View 1bwb on RCSB PDB site
Description: hiv-1 protease (v82f/i84v) double mutant complexed with sd146 of dupont pharmaceuticals
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bwba_
  • Chain 'B':
    Domains in SCOP 1.55: d1bwbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwbA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwbB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf