PDB entry 1bwb

View 1bwb on RCSB PDB site
Description: hiv-1 protease (v82f/i84v) double mutant complexed with sd146 of dupont pharmaceuticals
Class: hydrolase
Keywords: hiv-1 protease, hydrolase
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (hiv-1 protease)
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1bwba_
• Chain 'B':
  Compound: protein (hiv-1 protease)
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1bwbb_
• Heterogens: 146, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwbA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwbB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf