PDB entry 1bw9

View 1bw9 on RCSB PDB site
Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate
Deposited on 1998-10-01, released 1999-05-18
The last revision prior to the SCOP 1.61 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw9A (A:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareast
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw9B (B:)
    sidsalnwdgemtvtrfdkmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrare