PDB entry 1bvg
View 1bvg on RCSB PDB site
Description: hiv-1 protease-dmp323 complex in solution, nmr minimized average structure
Class: aspartyl protease
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase
Deposited on
1996-01-16, released
1996-08-17
The last revision prior to the SCOP 1.73 freeze date was dated
1996-08-17, with a file datestamp of
2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1bvga_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1bvgb_ - Heterogens: DMP
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1bvgA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1bvgB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf