PDB entry 1bvg

View 1bvg on RCSB PDB site
Description: hiv-1 protease-dmp323 complex in solution, nmr minimized average structure
Class: aspartyl protease
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase
Deposited on 1996-01-16, released 1996-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 1996-08-17, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • engineered (94)
  Domains in SCOP 1.73: d1bvga_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • engineered (94)
  Domains in SCOP 1.73: d1bvgb_
• Heterogens: DMP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bvgA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bvgB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf