PDB entry 1bvc

View 1bvc on RCSB PDB site
Description: structure of a biliverdin apomyoglobin complex (form d) at 118 k
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-16, released 1995-07-31
The last revision prior to the SCOP 1.75 freeze date was dated 1995-07-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apomyoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bvca_
  • Heterogens: PO4, BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bvcA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg