PDB entry 1bv8

View 1bv8 on RCSB PDB site
Description: receptor domain from alpha-2-macroglobulin
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-05, with a file datestamp of 2000-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bv8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bv8A (A:)
eefpfalgvqtlpqtcdepkahtsfqislsvsytgsrsasnmaivdvkmvsgfiplkptv
kmlersnhvsrtevssnhvliyldkvsnqtlslfftvlqdvpvrdlkpaivkvydyyetd
efaiaeynapcskdlgna