PDB entry 1bv7

View 1bv7 on RCSB PDB site
Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bv7a_
  • Chain 'B':
    Domains in SCOP 1.57: d1bv7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bv7A (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bv7B (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf