PDB entry 1bv1

View 1bv1 on RCSB PDB site
Description: birch pollen allergen bet v 1
Class: allergen
Keywords: allergen, pathogenesis-related protein
Deposited on 1997-07-08, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bet v 1
    Species: Betula pendula [TaxId:3505]
    Gene: BET V 1 1.2801
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bv1A (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn