PDB entry 1bur

View 1bur on RCSB PDB site
Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate
Class: lyase
Keywords: carbon dioxide fixing enzyme, lyase
Deposited on 1996-04-09, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 1997-01-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.06: d1bura3, d1bura4
  • Chain 'B':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.06: d1burb3, d1burb4
  • Chain 'C':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.06: d1burc3, d1burc4
  • Chain 'D':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.06: d1burd3, d1burd4
  • Chain 'S':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (5)
      • see remark 999 (8)
      • see remark 999 (11)
      • see remark 999 (35-36)
      • conflict (40)
      • see remark 999 (55)
      • conflict (76)
      • see remark 999 (83)
      • see remark 999 (86)
      • see remark 999 (89)
      • conflict (93)
      • see remark 999 (98)
      • conflict (100)
      • conflict (104-105)
      • conflict (108)
      • see remark 999 (55)
    Domains in SCOPe 2.06: d1burs_
  • Chain 'T':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Domains in SCOPe 2.06: d1burt_
  • Chain 'U':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (5)
      • see remark 999 (8)
      • see remark 999 (11)
      • see remark 999 (35-36)
      • conflict (40)
      • see remark 999 (55)
      • conflict (76)
      • see remark 999 (83)
      • see remark 999 (86)
      • see remark 999 (89)
      • conflict (93)
      • see remark 999 (98)
      • conflict (100)
      • conflict (104-105)
      • conflict (108)
      • see remark 999 (55)
    Domains in SCOPe 2.06: d1buru_
  • Chain 'V':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea
    Domains in SCOPe 2.06: d1burv_
  • Heterogens: MG, CAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1burA (A:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1burA (A:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1burB (B:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1burB (B:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1burC (C:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1burC (C:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1burD (D:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1burD (D:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burS (S:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burT (T:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burU (U:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burV (V:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy