PDB entry 1bur

View 1bur on RCSB PDB site
Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate
Deposited on 1996-04-09, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burA (A:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burB (B:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burC (C:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burD (D:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burS (S:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burT (T:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burU (U:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1burV (V:)
    mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg
    yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
    agy