PDB entry 1buo

View 1buo on RCSB PDB site
Description: btb domain from plzf
Class: gene regulation
Keywords: protein-protein interaction domain, transcriptional repressor, zinc-finger protein, protein structure, promyelocytic leukemia, gene regulation
Deposited on 1998-09-04, released 1998-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (promyelocytic leukemia zinc finger protein plzf)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1buoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buoA (A:)
    mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
    nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
    q