PDB entry 1buo

View 1buo on RCSB PDB site
Description: btb domain from plzf
Class: gene regulation
Keywords: protein-protein interaction domain, transcriptional repressor, zinc-finger protein, x-ray crystallography, protein structure, promyelocytic leukemia
Deposited on 1998-09-04, released 1998-10-14
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (promyelocytic leukemia zinc finger protein plzf)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1buoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1buoA (A:)
mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
q