PDB entry 1bun
View 1bun on RCSB PDB site
Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
Class: toxin
Keywords: hydrolase, presynaptic neurotoxin
Deposited on
1995-10-15, released
1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: beta2-bungarotoxin
Species: Bungarus multicinctus [TaxId:8616]
Database cross-references and differences (RAF-indexed):
- Uniprot P00617 (0-119)
- conflict (65-66)
- conflict (86)
- conflict (102)
- conflict (104)
Domains in SCOPe 2.07: d1buna_ - Chain 'B':
Compound: beta2-bungarotoxin
Species: Bungarus multicinctus [TaxId:8616]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1bunb_ - Heterogens: NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1bunA (A:)
nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1bunB (B:)
rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
r