PDB entry 1bu3

View 1bu3 on RCSB PDB site
Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Deposited on 1998-08-30, released 1999-08-10
The last revision prior to the SCOP 1.61 freeze date was dated 1999-08-10, with a file datestamp of 1999-08-09.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.214
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bu3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bu3_ (-)
    afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
    delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka