PDB entry 1bu2

View 1bu2 on RCSB PDB site
Description: x-ray structure of a viral cyclin from herpesvirus saimiri
Deposited on 1998-09-10, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.242
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bu2A (A:)
    rvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfeldksvfplsvsild
    rylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcftnlelinqekdile
    alkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicag
    gllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd