PDB entry 1btv

View 1btv on RCSB PDB site
Description: structure of bet v 1, nmr, 20 structures
Class: major birch pollen allergen
Keywords: major birch pollen allergen, ige-allergy, pr-10 protein
Deposited on 1997-01-30, released 1997-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bet v 1
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btvA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn