PDB entry 1btp

View 1btp on RCSB PDB site
Description: unique binding of a novel synthetic inhibitor, n-[3-[4-[4-(amidinophenoxy)-carbonyl]phenyl]-2-methyl-2-propenoyl]-n-allylglycine methanesulfonate to bovine trypsin, revealed by the crystal structure of the complex
Deposited on 1995-08-11, released 1996-01-29
The last revision prior to the SCOP 1.59 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1btp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btp_ (-)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn