PDB entry 1bte

View 1bte on RCSB PDB site
Description: crystal structure of the extracellular domain of the type II activin receptor
Class: transferase
Keywords: receptor, serine kinase, ligand binding domain, three-finger toxin, transferase
Deposited on 1998-09-01, released 1999-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (activin receptor type II)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1btea_
  • Chain 'B':
    Compound: protein (activin receptor type II)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bteb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bteA (A:)
    setqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddin
    cydrtdciekkdspevyfcccegnmcnekfsyfpeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bteA (A:)
    etqeclffnanwerdrtnqtgvepcygrrhcfatwknisgsieivkqgcwlddincydrt
    dciekkdspevyfcccegnmcnekfsyfpeme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bteB (B:)
    setqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddin
    cydrtdciekkdspevyfcccegnmcnekfsyfpeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bteB (B:)
    etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
    ydrtdciekkdspevyfcccegnmcnekfsyfpe