PDB entry 1bt7

View 1bt7 on RCSB PDB site
Description: the solution nmr structure of the n-terminal protease domain of the hepatitis c virus (hcv) ns3-protein, from bk strain, 20 structures
Deposited on 1998-09-01, released 1999-06-22
The last revision prior to the SCOP 1.63 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1bt7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bt7_ (-)
    tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
    lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
    pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk