PDB entry 1bsw

View 1bsw on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5
Class: metal binding protein
Keywords: metalloproteinase, snake venom, mmp, metal binding protein
Deposited on 1998-08-31, released 1999-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (acutolysin a)
  Species: Deinagkistrodon acutus [TaxId:36307]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9PW35 (0-196)
  Domains in SCOPe 2.08: d1bswa_
• Heterogens: ZN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bswA (A:)
  fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
  lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
  gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
  iqcrdyiakenppciln