PDB entry 1bsq

View 1bsq on RCSB PDB site
Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin
Class: hormone/growth factor
Keywords: bovine beta-lactoglobulin, crystal structure, genetic variants, point mutation, hydrophobic, hormone/growth factor complex
Deposited on 1998-08-29, released 1998-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.239
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (beta-lactoglobulin)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.05: d1bsqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bsqA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi