PDB entry 1bsl

View 1bsl on RCSB PDB site
Description: structure of alkanal monooxygenase beta chain
Class: flavoprotein
Keywords: photoprotein, luminescence, oxidoreductase, monooxygenase, flavoprotein, fmn
Deposited on 1996-10-22, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsla_
  • Chain 'B':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bslb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bslA (A:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bslA (A:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bslB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs