PDB entry 1bsh

View 1bsh on RCSB PDB site
Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Deposited on 1998-08-27, released 1998-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bshA (A:)
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairgqdldearameakrkaeehissshgdvdyaqasae
lakaiaqlrvieltkkam