PDB entry 1brx

View 1brx on RCSB PDB site
Description: bacteriorhodopsin/lipid complex
Deposited on 1998-05-28, released 1999-01-27
The last revision prior to the SCOP 1.61 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1brx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1brx_ (-)
    grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
    ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
    altkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsay
    pvvwligsegagivplnietllfmvldvsakvgfglillrsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brx_ (-)
    grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
    ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
    altkvysyrfvwwaistaamlyilyvlvastfkvlrnvtvvlwsaypvvwligsegagiv
    plnietllfmvldvsakvgfglillrsra