PDB entry 1brr

View 1brr on RCSB PDB site
Description: x-ray structure of the bacteriorhodopsin trimer/lipid complex
Deposited on 1998-07-28, released 1998-09-30
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.256
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1brra_
  • Chain 'B':
    Domains in SCOP 1.61: d1brrb_
  • Chain 'C':
    Domains in SCOP 1.61: d1brrc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brrA (A:)
    qitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmll
    gygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtg
    lvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlw
    saypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brrB (B:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brrC (C:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge