PDB entry 1brl

View 1brl on RCSB PDB site
Description: three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution
Class: luminescence
Keywords: monooxygenase, luminescence
Deposited on 1995-03-20, released 1996-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brla_
  • Chain 'B':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brlb_
  • Chain 'C':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brlc_
  • Chain 'D':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brld_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brlA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
    vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brlA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgyddtnrridysyeinpvgtpeeciaiiqqdi
    datgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1brlB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brlB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnani
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1brlC (C:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
    vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brlC (C:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgyddtnrridysyeinpvgtpeeciaiiqqdi
    datgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1brlD (D:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brlD (D:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnani