PDB entry 1brf

View 1brf on RCSB PDB site
Description: Rubredoxin (Wild Type) from Pyrococcus Furiosus
Class: electron transport
Keywords: iron-sulfur protein, high-resolution structure, electron transport
Deposited on 1998-08-24, released 1998-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.132
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (rubredoxin)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1brfa_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brfA (A:)
    akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled