PDB entry 1bre

View 1bre on RCSB PDB site
Description: immunoglobulin light chain protein
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1995-07-19, released 1995-10-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1brea_
  • Chain 'B':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1breb_
  • Chain 'C':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1brec_
  • Chain 'D':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1bred_
  • Chain 'E':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1bree_
  • Chain 'F':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA (GENBANK ACCESSION CODE
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-End)
    Domains in SCOPe 2.01: d1bref_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1breA (A:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breA (A:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1breB (B:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breB (B:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1breC (C:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breC (C:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1breD (D:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breD (D:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1breE (E:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breE (E:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1breF (F:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1breF (F:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik