PDB entry 1bre

View 1bre on RCSB PDB site
Description: immunoglobulin light chain protein
Deposited on 1995-07-19, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1brea_
  • Chain 'B':
    Domains in SCOP 1.55: d1breb_
  • Chain 'C':
    Domains in SCOP 1.55: d1brec_
  • Chain 'D':
    Domains in SCOP 1.55: d1bred_
  • Chain 'E':
    Domains in SCOP 1.55: d1bree_
  • Chain 'F':
    Domains in SCOP 1.55: d1bref_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breA (A:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breB (B:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breC (C:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breD (D:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breE (E:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1breF (F:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik