PDB entry 1brd

View 1brd on RCSB PDB site
Description: Model for the structure of Bacteriorhodopsin based on high-resolution Electron Cryo-microscopy
Deposited on 1990-05-23, released 1991-04-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: EDIF
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1brd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1brd_ (-)
    pewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyglt
    mvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvgal
    tkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypv
    vwligsegagivplnietllfmvldvsakvgfglillrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brd_ (-)
    pewiwlalgtalmglgtlyflvkgmgdakkfyaittlvpaiaftmylsmllgeqnpiywa
    ryadwlfttplllldlallvgtilalvgadgimigtglvgaltwwaistaamlyilyvlf
    fgftsevastfkvlrnvtvvlwsaypvvwlignietllfmvldvsakvgfglillrs