PDB entry 1brc

View 1brc on RCSB PDB site
Description: relocating a negative charge in the binding pocket of trypsin
Deposited on 1992-12-17, released 1994-05-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.71: d1brce_
  • Chain 'I':
    Domains in SCOP 1.71: d1brci_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1brcE (E:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1brcI (I:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg