PDB entry 1bra

View 1bra on RCSB PDB site
Description: relocating a negative charge in the binding pocket of trypsin
Deposited on 1992-12-17, released 1994-04-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.156
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bra__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bra_ (-)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan