PDB entry 1bqs

View 1bqs on RCSB PDB site
Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)
Class: membrane protein
Keywords: cell adhesion protein, madcam-1, immunoglobulin fold, I-set fold, cell adhesion glycoprotein, integrin recoginition, membrane protein
Deposited on 1998-08-18, released 1999-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mucosal addressin cell adhesion molecule-1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-208)
      • conflict (93)
    Domains in SCOPe 2.07: d1bqsa1, d1bqsa2
  • Heterogens: NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqsA (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
    ycqatmrlpglelshrqaipvlhsptspe