PDB entry 1bqr

View 1bqr on RCSB PDB site
Description: reduced pseudoazurin
Class: electron transport
Keywords: electron transport, cuproprotein
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bqra_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqrA (A:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn