PDB entry 1bqq

View 1bqq on RCSB PDB site
Description: crystal structure of the mt1-mmp--timp-2 complex
Class: hydrolase/hydrolase inhibitor
Keywords: matrix metalloproteinase, tissue inhibitor of metalloproteinases, proteinase complex, pro-gelatinase a activator, crystal structure, complex (metalloproteinase/receptor), hydrolase/hydrolase inhibitor complex
Deposited on 1998-08-18, released 1999-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: membrane-type matrix metalloproteinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bqqm_
  • Chain 'T':
    Compound: metalloproteinase inhibitor 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bqqt_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqqM (M:)
    iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
    qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
    flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqqT (T:)
    cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
    efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
    ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
    aapp