PDB entry 1bqh

View 1bqh on RCSB PDB site
Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8
Class: immune system
Keywords: T-cell, coreceptor, glycoprotein, complex, immunology, antigen, immune system
Deposited on 1998-08-16, released 1998-08-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (h-2 class I histocompatibility antigen)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bqha1, d1bqha2
  • Chain 'B':
    Compound: protein (beta-2-microglobulin )
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bqhb_
  • Chain 'C':
    Compound: protein (vsv8)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BQH (0-7)
  • Chain 'D':
    Compound: protein (h-2 class I histocompatibility antigen)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bqhd1, d1bqhd2
  • Chain 'E':
    Compound: protein (beta-2-microglobulin )
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bqhe_
  • Chain 'F':
    Compound: protein (vsv8)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BQH (0-7)
  • Chain 'G':
    Compound: protein (cd8a or lyt2 or lyt-2)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bqhg_
  • Chain 'H':
    Compound: protein (cd8a or lyt2 or lyt-2)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01731 (0-End)
      • conflict (122)
      • conflict (124)
    Domains in SCOPe 2.03: d1bqhh_
  • Chain 'I':
    Compound: protein (cd8a or lyt2 or lyt-2)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01731
      • conflict (122)
      • conflict (124)
    Domains in SCOPe 2.03: d1bqhi_
  • Chain 'K':
    Compound: protein (cd8a or lyt2 or lyt-2)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01731 (0-End)
      • conflict (122)
      • conflict (124)
    Domains in SCOPe 2.03: d1bqhk_
  • Heterogens: NDG, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqhA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqhB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqhD (D:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqhE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bqhG (G:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssadlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqhG (G:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bqhH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssadlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqhH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1bqhI (I:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssadlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqhI (I:)
    apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
    twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
    sa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1bqhK (K:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssadlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqhK (K:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssa