PDB entry 1bq9

View 1bq9 on RCSB PDB site
Description: Rubredoxin (Formyl Methionine Mutant) from Pyrococcus Furiosus
Class: metal binding protein
Keywords: iron-sulfur protein, high-resolution structure, metal binding protein
Deposited on 1998-08-22, released 1998-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (rubredoxin)
  Species: Pyrococcus furiosus, synthetic [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-53)
    • modified amino acid (0)
  Domains in SCOPe 2.06: d1bq9a_
• Heterogens: FE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bq9A (A:)
  makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled