PDB entry 1bq9

View 1bq9 on RCSB PDB site
Description: rubredoxin (formyl methionine mutant) from pyrococcus furiosus
Deposited on 1998-08-22, released 1998-08-26
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bq9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq9A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled