PDB entry 1bq7

View 1bq7 on RCSB PDB site
Description: dsba mutant p151a, role of the cis-proline in the active site of dsba
Deposited on 1998-08-21, released 1999-08-20
The last revision prior to the SCOP 1.63 freeze date was dated 1999-08-20, with a file datestamp of 1999-08-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7A (A:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7B (B:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7C (C:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7D (D:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7E (E:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq7F (F:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse