PDB entry 1bq6

View 1bq6 on RCSB PDB site
Description: chalcone synthase from alfalfa with coenzyme a
Class: transferase
Keywords: transferase, polyketide synthase, chalcone biosynthesis
Deposited on 1998-08-21, released 1999-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.168
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (0-387)
      • conflict (162)
    Domains in SCOPe 2.07: d1bq6a1, d1bq6a2
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq6A (A:)
    vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
    ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
    skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvw
    taqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwi
    ahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglktt
    geglewgvlfgfgpgltietvvlrsvai