PDB entry 1bq0

View 1bq0 on RCSB PDB site
Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
Deposited on 1998-08-20, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1bq0__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bq0_ (-)
  akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
  kraaydqyghaafeqgg