PDB entry 1bpv

View 1bpv on RCSB PDB site
Description: titin module a71 from human cardiac muscle, nmr, 50 structures
Class: connectin
Keywords: titin, connectin, fibronectin type III
Deposited on 1998-08-11, released 1999-08-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1bpva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bpvA (A:)
mhhhhhhsspidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlka
nfsnileneftvsgltedaayefrviaknaagaisppsepsdaitcrddvea

    Sequence, based on observed residues (ATOM records): (download) 
    >1bpvA (A:)
spidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlkanfsnilen
eftvsgltedaayefrviaknaagaisppsepsdaitcrddvea