PDB entry 1bpd

View 1bpd on RCSB PDB site
Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism
Deposited on 1994-04-12, released 1994-06-22
The last revision prior to the SCOP 1.67 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 3.6 Å
R-factor: 0.193
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bpd_ (-)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpd_ (-)
    etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
    iaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkn
    edklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaess
    gdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyp
    hrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvagepl
    pvdseqdifdyiqwryrepkdrse